PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016501699.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 91aa    MW: 10699.4 Da    PI: 10.6148
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016501699.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.32.4e-121503687
                    EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3 36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                    ++l+de+ r W v++     + ++ +t+GW++F +an++++gD+  F+l+++
  XP_016501699.1  1 MILRDEKQRLWPVQV--GPVGHQFSITRGWRQFREANNVQVGDTYKFELIDN 50
                    579************..999999*************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF023621.4E-10152IPR003340B3 DNA binding domain
CDDcd100173.05E-10160No hitNo description
PROSITE profilePS5086312.802161IPR003340B3 DNA binding domain
SuperFamilySSF1019366.08E-14159IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.0E-13159IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MILRDEKQRL WPVQVGPVGH QFSITRGWRQ FREANNVQVG DTYKFELIDN GTIPVAHFHC  60
KYLGRMSSIR VVIDNVKKQL VIGKENEHRR I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016501699.15e-63PREDICTED: B3 domain-containing protein REM1-like
TrEMBLK4CIA85e-29K4CIA8_SOLLC; Uncharacterized protein
STRINGSolyc08g006190.1.12e-28(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.15e-07B3 family protein